Domain, hostname, URL or IP address:

173.254.28.234 is IP address of ravenhawksmagickalmysticalplaces.com

Ravenhawksmagickalmysticalplaces.com has 1 IP address is 173.254.28.234, associated with it.

The internet host name corresponding to this IP address: just2024.justhost.com

IP location: ↗


Visit website: ↗

What is site IP, or IP address of website

IP (short for Internet Protocol) is method by which information is sent between any two objects (website, user, computer) on the Internet. An IP address is used to identify an object at given moment. So, every web site has at least an IP address.

However, this may not mean a lot in practice, depending on what you're trying to accomplish. For example, websites may have multiple IP addresses, because of redundancy or because they're being served out of multiple datacenters. Additionally, it is possible for a single IP address to be assigned to a web server which hosts multiple websites.

Also, websites and computers connected to the Internet may have one or both types of IP addresses: IP version 4 (IPv4) and/or IP version 6 (IPv6).

Most recent lookup

Cookies

We may use cookies to make interactions with our website and services easy and meaningful, better understand how they are used and to tailor advertising, and give you the best experience. By continuing to use this site you are giving us your consent to do this.

Terms & Privacy

The information forward from this site may be provided by third parties. We will not be responsible with outside links, contents from source of information, methods of using, using or consequence of contents with users. All direct or indirect risk related to use of this site is borne entirely by you, the user.

We use advertising companies as Google AdSense, to serve ads when you visit our website. These companies may use information (not including your name, address, email address, or telephone number) about your visits to this and other websites in order to provide advertisements about goods and services of interest to you. If you would like more information about this practice and to know your choices about not having this information used by these companies, see https://policies.google.com/technologies/ads.

My FB Home